PCOC1_RAT   O08628


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O08628

Recommended name:Procollagen C-endopeptidase enhancer 1

EC number:

Alternative names:

Cleaved into:

GeneID:29569

Gene names  (primary ):Pcolce

Gene names  (synonym ):Pcpe1

Gene names  (ORF ):

Length:468

Mass:50,185

Sequence:MLPAALTSLLGPFLLAWVLPLARGQTPNYTRPVFLCGGDVTGESGYVASEGFPNLYPPNKKCIWTITVPEGQTVSLSFRVFDMELHPSCRYDALEVFAGSGTSGQRLGRFCGTFRPAPVVAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCGGRMEKAQGTLTTPNWPESDYPPGISCSWHIIAPSNQVIMLTFGKFDVEPDTYCRYDSVSVFNGAVSDDSKRLGKFCGDKAPSPISSEGNELLVQFVSDLSVTADGFSASYRTLPRDAVEKESAPSPGEDAQHGPQSRSDPKTGTGPKVKPPSKPKVQPVEKPEGSPATQATPVAPDAPSITCPKQYKRSGTLQSNFCSSSLVVTGTVKAMVRGPGEGLTVTVSLLGVYKTGDLDLPSPASGTSLKFYVPCKQMPPMKKGASYLLMGQVEENRGPILPPESFVVLYRPNQDQILSNLSKRKCPSQPRPDA

Tissue specificity:Expressed at highest levels in collagen-rich tissues, especially tendon. Also expressed in cornea and sterna. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp