DESPR_RAT D3ZGZ6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D3ZGZ6
Recommended name：Dual endothelin-1/VEGF signal peptide receptor By Similarity
EC number：
Alternative names：Dual endothelin-1/angiotensin-2 receptor 1 Publication (Dear protein 1 Publication) FBXW7 antisense RNA 1 homolog By Similarity
Cleaved into：
GeneID：446170
Gene names (primary )：Fbxw7-as1 By Similarity
Gene names (synonym )：Dear Imported
Gene names (ORF )：
Length：127
Mass：13,733
Sequence：MSTFYVTAVPKSHSSLPKCQAMMSRTLLTGMAMYLDSSHAGAASMQVSWPPLLTSLGSKEMKSRWNWGSITCIMCFTCVGSQLSMSSSKASNFSGPLQLYQRGIGHITNPYRRPPAPAWPCSSSGTT
Tissue specificity：Prominently expressed in brain and heart tissues. Weakly expressed in aorta, adrenal gland, and lung tissues. 1
Induction：
Developmental stage：
Protein families：