S35A4_RAT Q91ZR7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91ZR7
Recommended name：Probable UDP-sugar transporter protein SLC35A4 Curated
EC number：
Alternative names：
Cleaved into：
GeneID：257647
Gene names (primary )：Slc35a4
Gene names (synonym )：Clrp 1 Publication
Gene names (ORF )：
Length：324
Mass：34,705
Sequence：MSVEDGGMPGLARPKQARWTLMLFLSTAMYGAHAPFLALCHVDGRVPFRPSSAVLLTELTKLLLCAFSLLVGWQTWPQGTPPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLSNLKIGSTALLYCLCLGHRLSARQGLALLLLMAAGACYASGGFQEPGNTLPGPRSAAGARPMPLHITPLGLLLLILYCLISGLSSVYTELIMKRQRLPLALQNLFLYTFGVILNLGLYAGSGPGPGFLEGFSGWAVLVVLNQAVNGLLMSAVMKHGSSITRLFIVSCSLVVNAVLSAVLLQLQLTATFFLAALLIGLAVCLYYGSP
Tissue specificity：Expressed in the kidney, lung, testis, and prostate. Expressed in the brain by sets of neurons, such as the pyramidal cells of the cortex, the Purkinje cells of the cerebellum, and the motoneurons of the brainstem. 1
Induction：
Developmental stage：Expressed at 15 dpc. Expression is maintained until postnatal day 10 and decreases in adults. 1
Protein families：