C99L2_RAT Q8R1R5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R1R5
Recommended name：CD99 antigen-like protein 2
EC number：
Alternative names：CD99
Cleaved into：
GeneID：RGD:620896
Gene names (primary )：Cd99l2
Gene names (synonym )：Mic2l1, Rhombex40
Gene names (ORF )：
Length：246
Mass：26,074
Sequence：MVARLTTLLVCLVFSLATLVQRGYGDFDDFNLEDALKETSSVKQSHFSTTTRRTGTTRAPANPAERWDHMTTTTTKRPGTTRAPSNPLELDGFDLEDALDDRNDLDGPKKPSTGEGGGLSDKDLEDILGGGGYKPDKNKGGGGGYGSQDDPGSGAVTDPGTIAGLVSALAAALLGAVSGYLSYQHRKFCFSVQRGLDAAYVKGENLEAVVCEEPRVEAAMCEAPPVTDSTQHSQPTEPLAPERPRI
Tissue specificity：Expressed predominantly in the ventral medullary surface of the brain, moderate expression in the cerebral cortex and cerebellum. Low expression in lung and kidney. No expression in heart, stomach, intestine and skeletal muscle.
Induction：
Developmental stage：
Protein families：