MYL9_RAT Q64122
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64122
Recommended name:Myosin regulatory light polypeptide 9
EC number:
Alternative names:
Cleaved into:
GeneID:296313
Gene names (primary ):Myl9
Gene names (synonym ):Myrl2
Gene names (ORF ):
Length:171
Mass:19,721
Sequence:MSSKRAKAKTTKKRPQSATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEXLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYRERIDKKGNFNYVEFTRILKHGAKDKDD
Tissue specificity:Smooth muscle tissues and in some, but not all, nonmuscle cells. 1
Induction:
Developmental stage:
Protein families: