U119A_RAT Q62885
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62885
Recommended name：Protein unc-119 homolog A
EC number：
Alternative names：
Cleaved into：
GeneID：29402
Gene names (primary )：Unc119
Gene names (synonym )：Rg4
Gene names (ORF )：
Length：240
Mass：27,048
Sequence：MKVKKGGGGTGPGAEPVPGASNRSVEPTREPGAEAESGSESEPEPGPGPRLGPLQGKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Tissue specificity：Begins to be highly expressed around postnatal day 5 in the outer retina when the photoreceptors begin to differentiate and rapidly increases in expression to reach the mature adult level by postnatal day 23.
Induction：
Developmental stage：
Protein families：PDE6D/unc-119 family