ELMD3_RAT Q5XIQ2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5XIQ2
Recommended name：ELMO domain-containing protein 3
EC number：
Alternative names：
Cleaved into：
GeneID：297342
Gene names (primary )：Elmod3
Gene names (synonym )：Rbed1
Gene names (ORF )：
Length：356
Mass：40,014
Sequence：MSETSCSFLIEKEFQDGQVESVSAGLSPSYKDNGALMAFRGIPISELKNHGILQVLTAETNGWQPGVVSAEMLRAQEEWEVVDTIHPDIESGVSSQQPGQFISFNEALEHFQTVDLSSFKKRIQPTIQRTGLAALRHCLFGPPKLHQGLQEERDLVLTIAQCGLDSQNPTHGRVLQTIYKKLTGSKFDCALHGDHWEDLGFQGANPATDLRGTGFLALLHLLYLVMDSKTLLMAQEILRLSHHHIQQFPFCLMSVNITRIAIQALREECLSRECNRRRKVIPVVNSFYAATFLHLARMWRTQHNTILDSGFVLKELGIEPRALRSIGKRSTAELNPQPAPAFLVWDYSRAFMHGSR
Tissue specificity：Expressed in the cochlea and in the organ of Corti, as well as in the supporting cells, including pillar and Dieters' cells (at protein level). 1
Induction：
Developmental stage：At P02, in the organ of Corti, expressed in the stereocilia of outer hair cells and in the kinocilia of both outer and inner hair cells. Also concentrated at the cuticular plate level of auditory hair cells. However, before P07, expression in the inner hair cell stereocilia is very weak. By P07, in auditory hair cells, patchy expression detected along the length of stereocilia, but absent from the very tip. Later in development, detected in the stereocilia bundles and microvilli of sensory cells and also in the supporting cell bodies (at protein level).
Protein families：