TFPI1_RAT Q02445
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q02445
Recommended name：Tissue factor pathway inhibitor
EC number：
Alternative names：Extrinsic pathway inhibitor (EPI) Lipoprotein-associated coagulation inhibitor (LACI)
Cleaved into：
GeneID：29436
Gene names (primary )：Tfpi
Gene names (synonym )：
Gene names (ORF )：
Length：302
Mass：34,554
Sequence：MTNKLKKDHAFWAAVCLLLSIVPELLNALPEEDDDTINTDSELRPMKPLHTFCAMKAEDGPCKAMIRSYYFNMNSHQCEEFIYGGCRGNKNRFDTLEECRKTCIPGYKKTTIKTTSGAEKPDFCFLEEDPGICRGFMTRYFYNNQSKQCEQFKYGGCLGNSNNFETLEECRNTCEDPVNEVQKGDYVTNQITVTDRTTVNNVVIPQATKAPSQWDYDGPSWCLEPADSGLCKASEKRFYYNPAIGKCRQFNYTGCGGNNNNFTTKQDCNRACKKDSSKKSSKRAKTQRRRKSFVKVMYENIH
Tissue specificity：Most abundant in heart, lung, kidney, and aortic endothelial cells.
Induction：
Developmental stage：
Protein families：