RASM_RAT   P97538


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97538

Recommended name:Ras-related protein M-Ras

EC number:EC:3.6.5.2

Alternative names:Ras-related protein R-Ras3

Cleaved into:

GeneID:

Gene names  (primary ):Mras

Gene names  (synonym ):Rras3

Gene names  (ORF ):

Length:208

Mass:23,887

Sequence:MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQVPEKNQKKKKKTKWRGDRATGTHKLQCVIL

Tissue specificity:Expressed in skeletal muscle cells.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp