FABP6_RAT P80020
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P80020
Recommended name：Gastrotropin
EC number：
Alternative names：14 kDa bile acid-binding protein Fatty acid-binding protein 6 I-BABP Ileal lipid-binding protein (ILBP) Intestinal 15 kDa protein (I-15P)
Cleaved into：
GeneID：25440
Gene names (primary )：Fabp6
Gene names (synonym )：Ilbp, Illbp
Gene names (ORF )：
Length：128
Mass：14,544
Sequence：MAFTGKYEFESEKNYDEFMKRLGLPDEVIERGRNFKIITEVQQDGENFTWSQSYSGGNIMSNKFTIGKECEMQTMGGKKFKATVKMEGGKVVADFPNYHQTSEVVGDKLVEISTIGDVTYERVSKRVA
Tissue specificity：Predominantly expressed in ileum; also expressed in ovary. 2 s
Induction：
Developmental stage：
Protein families：calycin superfamily