NOE3_RAT P63057
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63057
Recommended name：Noelin-3
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Olfm3
Gene names (synonym )：Noe3
Gene names (ORF )：
Length：478
Mass：54,886
Sequence：MSAPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSAPDTLTQISPKEGWQVYSSAQDPDGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQMKGLKAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSSVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNGSLYFNKYQSNIIIKYSFDLGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVYATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT
Tissue specificity：Expressed in the brain (at protein level). Also expressed in the retina, mainly in the ganglion cell layer and in the amacrine cell subregion of the inner nuclear layer. Expressed at high levels in the epithelial cells of the posterior iris and the ciliary body and, at lower levels, in the trabecular meshwork. Isoform 2 preferentially expressed in retina and brain, while isoform 1 preferentially expressed in the tissues of the eye angle. 2 s
Induction：
Developmental stage：
Protein families：