GBB3_RAT P52287
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P52287
Recommended name：Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
EC number：
Alternative names：
Cleaved into：
GeneID：60449
Gene names (primary )：Gnb3
Gene names (synonym )：
Gene names (ORF )：
Length：340
Mass：37,180
Sequence：MGEMEQLKQEAEQLKKQIADARKACADITLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYSLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDYKLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELTAYSHESIICGITSVAFSLSGRLLFAGYDDFNCNVWDSLKCERVGVLSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN
Tissue specificity：Expressed at a high level in the heart and at a much lower level in the brain.
Induction：
Developmental stage：
Protein families：