GPR6_RAT   P51651


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51651

Recommended name:G-protein coupled receptor 6

EC number:

Alternative names:

Cleaved into:

GeneID:83683

Gene names  (primary ):Gpr6

Gene names  (synonym ):Cnl3

Gene names  (ORF ):

Length:363

Mass:38,115

Sequence:MNASAAALNESQVVAVAAEGAAAAATAAGTPDTSEWGPPAASAALGGGGGPNGSLELSSQLPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRASCSVVRPLTRSHVALLSTSFFVVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLFCGCFQSKVPFRSRSPSEV

Tissue specificity:Expressed in the brain, with a prominent distribution in striatum. 1

Induction:

Developmental stage:Abundantly expressed in granule neurons at all developmental stages. 1

Protein families:


   💬 WhatsApp