PDCD2_RAT P47816
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47816
Recommended name：Programmed cell death protein 2
EC number：
Alternative names：
Cleaved into：
GeneID：58934
Gene names (primary )：Pdcd2
Gene names (synonym )：Rp8
Gene names (ORF )：
Length：343
Mass：38,444
Sequence：MAAVVPVTVELGFVEEAPAWRLRSEQFPSKVGGRPAWLALAELPGPGALACARCGRPLAFLLQVYAPLPGRDEAFHRSLFLFCCREPLCCAGLRVFRNQLPRKNAFYSYEPPSETGASDTECVCLQLKSGAHLCRVCGCLAPMTCSRCKQAHYCSKEHQTLDWQLGHKQACTQSDHLDHMVPDHNFLFPEFEIVTETEDEIGPEVVEMEDYSEVIGSMEGVPEEELDSMAKHESKEDHIFQKFKSKIALEPEQILRYGRGIKPIWISGENIPQEKDIPDCSCGAKRIFEFQVMPQLLNHLKADRLGTSVDWGILAVFTCAESCSLGIGYTEEFVWKQDVTETP
Tissue specificity：By irradiation and dexamethasone.
Induction：
Developmental stage：Expressed during apoptosis.
Protein families：