CRIS1_RAT P12020
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P12020
Recommended name：Cysteine-rich secretory protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：64827
Gene names (primary )：Crisp1
Gene names (synonym )：Aeg
Gene names (ORF )：
Length：246
Mass：27,847
Sequence：MALMLVLLFLAAVLPPSLLQDTTDEWDRDLENLSTTKLSVQEEIINKHNQLRRTVSPSGSDLLRVEWDHDAYVNAQKWANRCIYNHSPLQHRTTTLKCGENLFMANYPASWSSVIQDWYDESLDFVFGFGPKKVGVKVGHYTQVVWNSTFLVACGVAECPDQPLKYFYVCHYCPGGNYVGRLYSPYTEGEPCDSCPGNCEDGLCTNSCEYEDNYSNCGDLKKMVSCDDPLLKEGCRASCFCEDKIH
Tissue specificity：Secreted by the epididymal epithelium and then becomes associated with the sperm surface.
Induction：
Developmental stage：By androgens.
Protein families：