AUGN_RAT   D4A540


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D4A540

Recommended name:Augurin Curated

EC number:

Alternative names:

Cleaved into:

GeneID:363225

Gene names  (primary ):Ecrg4 Curated

Gene names  (synonym ):

Gene names  (ORF ):

Length:148

Mass:16,949

Sequence:MGTSSARPAVLALAGLALLLLLCLGPGDVSGNKLKKMLQKREGPVPSKTNVAVSEHTAKEFLGGLKRAKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDVNYWLNRNQNGHDYYGDYYQRHYDEDAAIGPRSREGFRHGASVNYDDY

Tissue specificity:Expressed in the brain, with expression in the choroid plexus and the ventricular ependymal cells (at protein level). 1

Induction:

Developmental stage:Decreased expression in the choroid plexus after penetrating injury in the central nervous system. 1

Protein families:


   💬 WhatsApp