NDRG4_RAT Q9Z2L9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z2L9
Recommended name：Protein NDRG4
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Ndrg4
Gene names (synonym )：Bdm1, Ndr4
Gene names (ORF )：
Length：352
Mass：38,487
Sequence：MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTLFNLEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLATMLPNVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLMNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQISSVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIAHLKDRRLSGGAVPSASMTRLARSRTASLTSASSVDGSRPQPCTHSDSSEGMGQVNHTMEVSC
Tissue specificity：Expressed in the brain and heart, weakly in the kidney; most prominently in postnatal brain where it is expressed widely in the olfactory bulb, cerebral cortex, hippocampus, cerebellum, thalamus, and medulla oblongata. 2 s
Induction：
Developmental stage：Isoform 1, isoform 2 and isoform 3 are detected in maturing and mature brain, whereas isoform 4, isoform 5 and isoform 6 are expressed in embryonic and early postnatal brain. All isoforms are expressed in heart. 1
Protein families：