RN138_RAT Q99PD2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99PD2
Recommended name：E3 ubiquitin-protein ligase RNF138 Curated
EC number：EC:2.3.2.27
Alternative names：RING finger protein 138 Curated RING-type E3 ubiquitin transferase RNF138 Curated
Cleaved into：
GeneID：94196
Gene names (primary )：Rnf138
Gene names (synonym )：RSD-4 1 Publication
Gene names (ORF )：
Length：209
Mass：24,072
Sequence：MSEELSADTSYTEDDFYCPVCQEVLKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRRERACPERAIDLENIMRRVSGSCRCCSKKIKFYRMRHHYKSCKKYQDEYGVSSVIPNVKISQDSVRSSNRSETSASDNTETYQEDTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVNLQLDEETQYQTAVEESFQVNM
Tissue specificity：
Induction：
Developmental stage：
Protein families：