LTC4S_RAT   Q925U2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q925U2

Recommended name:Leukotriene C4 synthase

EC number:EC:4.4.1.20

Alternative names:LTC4 synthase

Cleaved into:

GeneID:114097

Gene names  (primary ):Ltc4s

Gene names  (synonym ):

Gene names  (ORF ):

Length:150

Mass:16,850

Sequence:MKEETALLATVTLLGVLLQAYFSLQVISARRTFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQHRLDPLYASARALWLLVAMAALGLLVHFLPGTLRAALFRWLQVLLPMA

Tissue specificity:Up-regulated by all-trans retinoic acid. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp