VMP1_RAT Q91ZQ0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91ZQ0
Recommended name：Vacuole membrane protein 1 Curated
EC number：
Alternative names：
Cleaved into：
GeneID：192129
Gene names (primary )：Vmp1 1 Publication
Gene names (synonym )：
Gene names (ORF )：
Length：406
Mass：45,901
Sequence：MAENGTNCDQRRGAMSKEQHNGSFTDPSSVNEKKRRDREERQNIVLWRQPLITLQYFSLETLVVLKEWTSKLWHRQSMVVSFFLLLAALVATYYVEGAHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGAISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAETAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIVTFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHRSEAGTAQGENWLSWTFEKLVVAMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK
Tissue specificity：Highly expressed in intestine, kidney, ovary and placenta, moderately expressed in liver, lung, stomach, thymus, brain, and testis and slightly expressed in control thyroid and retina. Strongly expressed in pancreas (acinar cells) during acute pancreatitis. 1
Induction：
Developmental stage：Overexpressed only in pancreas during acute pancreatitis. Up-regulated by starvation. Up-regulated following MTOR-inhibition by rapamycin. 1
Protein families：VMP1 family