SCMC2_RAT Q8K3P6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K3P6
Recommended name：Mitochondrial adenyl nucleotide antiporter SLC25A25 By Similarity
EC number：
Alternative names：
Cleaved into：
GeneID：246771
Gene names (primary )：Slc25a25
Gene names (synonym )：Mcsc 1 Publication, Pcscl, Scamc2
Gene names (ORF )：
Length：469
Mass：52,695
Sequence：MLCLCLYVPIAGEAQTEFQYFESKGLPTELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIIGGFTQMIREGGAKSLWRGNGINVLKIAPESAIKFMAYEQMKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCAKRILAKEGVAAFYKGYIPNMLGIIPYAGIDLAVYETLKNTWLQRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQAQASIEGAPEVTMSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Tissue specificity：Mainly present in the liver and the skeletal muscle (at protein level). 1
Induction：In the liver, expression is higher in the adult stage than in the fetal stage. 1 Publication
Developmental stage：Up-regulated in dexamethasone-treated cells before the expression of albumin. 1
Protein families：