KISS1_RAT Q7TSB7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TSB7
Recommended name：Metastasis-suppressor KiSS-1
EC number：
Alternative names：Metastin Kisspeptin-10 Alternative names: Metastin45-54
Cleaved into：
GeneID：289023
Gene names (primary )：Kiss1
Gene names (synonym )：
Gene names (ORF )：
Length：130
Mass：14,188
Sequence：MISLASWQLLLLLCVASFGEPLAKMAPVVNPEPTGQQSGPQELVNAWQKGPRYAESKPGAAGLRARRTSPCPPVENPTGHQRPPCATRSRLIPAPRGSVLVQREKDMSAYNWNSFGLRYGRRQVARAARG
Tissue specificity：Highest levels in the cecum and colon. Moderate levels present in the liver, spleen, kidney, ovary, uterus and small intestine. Low levels in the stomach, pancreas and placenta. Expressed only moderately in the placenta. Persistent expression is detected in hypothalamus throughout postnatal development, with maximum expression levels at puberty in both male and female. Hypothalamic expression is sensitive to neonatal imprinting by estrogen. Expression is higher in the hypothalamus than in the brainstem and spinal cord. In the brain, metastin-like immunoreactivity is found mainly in three groups of cells: dorsomedial hypothalamic nucleus, nucleus of the solitary tract, and caudal ventrolateral medulla. 3 s
Induction：
Developmental stage：Expression observed in trophoblast giant cells (TGCs), the placenta-derived cell lineage aligned at the boundary between the uterus and placenta, at 12.5 dpc. Expressions gradually decreased during placental maturation, and the signal is no more detectable in the cells at 18.5 dpc. 1
Protein families：