CRIPT_RAT   Q792Q4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q792Q4

Recommended name:Cysteine-rich PDZ-binding protein

EC number:

Alternative names:

Cleaved into:

GeneID:56725

Gene names  (primary ):Cript

Gene names  (synonym ):

Gene names  (ORF ):

Length:101

Mass:11,271

Sequence:MVCEKCEKKLGRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV

Tissue specificity:Expressed in striatum, cortex, midbrain, Purkinje cells of the cerebellum, pyramidal neurons of the hippocampus and neuropil. Expressed in heart, brain, lung, liver, kidney and testis. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp