AKA7G_RAT Q6JP77
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6JP77
Recommended name：A-kinase anchor protein 7 isoforms delta and gamma
EC number：
Alternative names：A-kinase anchor protein 18 By Similarity AKAP-18 By Similarity Protein kinase A-anchoring protein 7 isoforms delta and gamma (PRKA7 isoforms delta and gamma)
Cleaved into：
GeneID：
Gene names (primary )：Akap7
Gene names (synonym )：Akap18 1 Publication
Gene names (ORF )：
Length：353
Mass：39,418
Sequence：MERPAAGEIDANKCDHLSRGEEGTGDLETSPVGSLADLPFAAVDIQDDCGLPDVPQGNVPQGNPKRSKENRGDRNDHVKKRKKAKKDYQPNYFLSIPITNKKITAGIKVLQNSILRQDNRLTKAMVGDGSFHITLLVMQLLNEDEVNIGTDALLELKPFVEEILEGKHLTLPFHGIGTFQGQVGFVKLADGDHVSALLEIAETAKRTFQEKGILAGESRTFKPHLTFMKLSKAPMLWKKGVRKIEPGLYEQFIDHRFGEEILYQIDLCSMLKKKQSNGYYHCESSIVIGEKDRKEPEDAELVRLSKRLVENAVLKAVQQYLEETQNKKQPGEGNSVKAEEGDRNGDGSDNNRK
Tissue specificity：Expressed highly in the heart, and moderately in brain, lung, liver, kidney and testis. Hardly detectable in spleen and skeletal muscle. In kidney, isoform Delta is expressed in the principal cells of the IMCD. 1
Induction：
Developmental stage：
Protein families：