PIAS2_RAT Q6AZ28
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6AZ28
Recommended name:E3 SUMO-protein ligase PIAS2
EC number:EC:2.3.2.-
Alternative names:Androgen receptor-interacting protein 3 (ARIP3) DAB2-interacting protein (DIP) E3 SUMO-protein transferase PIAS2 Curated Msx-interacting-zinc finger protein Protein inhibitor of activated STAT x Protein inhibitor of activated STAT2
Cleaved into:
GeneID:83422
Gene names (primary ):Pias2
Gene names (synonym ):Miz1, Piasx
Gene names (ORF ):
Length:572
Mass:63,431
Sequence:MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCTPAVQIKIRELYRRRYPRTLEGLSDLSTIKSSVFSLDGSSSPVEPDLAVAGIHSLPSTSIAPHSPSSPVASVLLQDTKPTFEMQQPSPPIPPVHPDVQLKTLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVTSQPCTKVESSSVFSKPCSVTVASDASKKKIDVIDLTIESSSDEEEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPVSSMSSDLPGEQRRNDINNEVQLGTSSDTVQQ
Tissue specificity:Mainly expressed in testis. 1
Induction:
Developmental stage:Expressed in spermatogonia and in primary spermatocytes up to late pachytene stage (at protein level).
Protein families:PIAS family