CSAD_RAT   Q64611


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q64611

Recommended name:Cysteine sulfinic acid decarboxylase

EC number:EC:4.1.1.29

Alternative names:Aspartate 1-decarboxylase Curated (EC:4.1.1.11 By Similarity) . EC:4.1.1.11 (UniProtKB | ENZYME | Rhea) By Similarity Cysteine-sulfinate decarboxylase Sulfinoalanine decarboxylase

Cleaved into:

GeneID:60356

Gene names  (primary ):Csad

Gene names  (synonym ):Csd

Gene names  (ORF ):

Length:493

Mass:55,249

Sequence:MADSKPLRTLDGDPVAVEALLRDVFGIVVDEAIRKGTNASEKVCEWKEPEELKQLLDLELQSQGESRERILERCRAVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNTGDGVFCPGGSISNMYAINLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGKMIPEDLERQISLAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWLHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYNVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLEWRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILVQADIDFLLGELERLGQDL

Tissue specificity:Expressed in brain, liver and kidney. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp