AGT2_RAT Q64565
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64565
Recommended name：Alanine--glyoxylate aminotransferase 2, mitochondrial
EC number：EC:2.6.1.44
Alternative names：AGT 2
Cleaved into：
GeneID：83784
Gene names (primary )：Agxt2
Gene names (synonym )：Agt2
Gene names (ORF )：
Length：512
Mass：57,201
Sequence：MSLAWRTLQKAFYLETSLRILQMRPSLSCASRIYVPKLTLHTKHNMPPCDFSPEKYQSLAYNHVLEIHKQHLSPVNTAYFQKPLLLHQGHMEWLFDSEGNRYLDFFSGIVTVGVGHCHPKVTAVAKKQMDRLWHTSSVFFHSPMHEYAERLSALLPEPLKVIFLVNSGSEANDLAMVMARAYSNHTDIISFRGAYHGCSPYTLGLTNVGIYKMKVPSTIACQSTMCPDVFRGPWGGSHCRDSPVQTVRKCSCAPDGCQAKERYIEQFKDTLNTSVATSIAGFFAEPIQGVNGVVQYPKEFLKEAFALVRERGGVCIADEVQTGFGRLGSHFWGFQTHDTMPDIVTMAKGIGNGFPMAAVVTTPEIASSLAKHLHHFSTFGGSPLACAIGSAVLEVIEEENLQRNSQEVGTYMLLKFAKLRDEFDIVGDVRGKGLMVGIEMVQDKISRQPLPKTEVNQIHEDCKDMGLLVGRGGNFSQTFRIAPPMRVTKLEVDFAFEVFRSALTQHMERRAK
Tissue specificity：Expressed in the liver, lung and kidney. 2 s
Induction：
Developmental stage：Expression is low at birth, increases sharply thereafter for 10 days, and then subsequently declines to the adult level. 1
Protein families：