BET1_RAT Q62896
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62896
Recommended name：BET1 homolog
EC number：
Alternative names：Golgi vesicular membrane-trafficking protein p18
Cleaved into：
GeneID：29631
Gene names (primary )：Bet1
Gene names (synonym )：
Gene names (ORF )：
Length：118
Mass：13,230
Sequence：MRRAGLGDGAPPGGYGNYGYANSGYNACEEENDRLTESLRSKVTAIKSLSIEIGHEVKNQNKLLAEMDSQFDSTTGFLGKTMGRLKILSRGSQTKLLCYMMLFSLFVFFVIYWIIKLR
Tissue specificity：
Induction：
Developmental stage：
Protein families：