5HT4R_RAT Q62758
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62758
Recommended name：5-hydroxytryptamine receptor 4
EC number：
Alternative names：Serotonin receptor 4
Cleaved into：
GeneID：
Gene names (primary )：Htr4
Gene names (synonym )：
Gene names (ORF )：
Length：406
Mass：46,107
Sequence：MDRLDANVSSNEGFGSVEKVVLLTFFAMVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVNAFGAIELVQDIWFYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDVIEKRKFNHNSNSTFCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRPQTADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEKVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRDTVECGGQWESRCHLTATSPLVAAQPVIRRPQDNDLEDSCSLKRSQS
Tissue specificity：In brain, isoform 5-HT4S is restricted to the striatum (PubMed:7796807). In peripheral tissues, differential expression is also observed in the atrium of the heart where only isoform 5-HT4S is detectable (PubMed:7796807). 1
Induction：
Developmental stage：In brain, isoform 5-HT4L is expressed throughout the brain, except in the cerebellum. 1
Protein families：G-protein coupled receptor 1 family