DEGS1_RAT   Q5XIF5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5XIF5

Recommended name:Sphingolipid delta(4)-desaturase DES1 Curated

EC number:EC:1.14.19.17

Alternative names:Degenerative spermatocyte homolog 1 Degenerative spermatocyte-like protein RDES Dihydroceramide desaturase-1 Retinol isomerase (EC:5.2.1.- By Similarity) . EC:5.2.1.- (UniProtKB | ENZYME | Rhea) By Similarity

Cleaved into:

GeneID:58970

Gene names  (primary ):Degs1

Gene names  (synonym ):Degs, Des1

Gene names  (ORF ):

Length:323

Mass:38,055

Sequence:MGNRVSREEFEWVYTDQPHAARRQEILAKYPEIKSLMKPDPNLIWIVTSMLLVQLASFYLVKDLDWKWLMFWSYAFGSCLNHSMTLAIHEISHNFPFGHHKAMWNRWFGMFANLSLGVPYSISFKRYHMDHHRYLGADGIDVDIPTDFEGWFFCTTLRKLVWVILQPLFYAFRPLFINPKPITHLEVINTVIQVTFDVLVYYVFGVKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNVPGKNLPLVRKIASEYYDNLPHYNSWIRVLYDFVMDDTISPYSRMKRPPKGNEIQE

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp