SIR2_RAT   Q5RJQ4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5RJQ4

Recommended name:NAD-dependent protein deacetylase sirtuin-2

EC number:EC:2.3.1.286

Alternative names:NAD-dependent protein defatty-acylase sirtuin-2 Curated (EC:2.3.1.- By Similarity) . EC:2.3.1.- (UniProtKB | ENZYME | Rhea) By Similarity Regulatory protein SIR2 homolog 2 SIR2-like protein 2

Cleaved into:

GeneID:

Gene names  (primary ):Sirt2

Gene names  (synonym ):Sir2l2

Gene names  (ORF ):

Length:350

Mass:39,319

Sequence:MDFLRNLFTQTLGLGSQKERLLDELTLEGVTRYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYANLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFIRLLKEKGLLLRCYTQNIDTLERVAGLEPQDLVEAHGTFYTSHCVNTSCGKEYTMSWMKEKIFSEATPKCEKCQNVVKPDIVFFGENLPPRFFSCMQSDFSKVDLLIIMGTSLQVQPFASLISKAPLATPRLLINKEKTGQTDPFLGMMMGLGGGMDFDSKKAYRDVAWLGDCDQGCLALADLLGWKELEDLVRREHANIDAQSGSQASNPSATVSPRKSPPPAKEAARTKEKEEH

Tissue specificity:Expressed in the cerebellum, cerebral cortex and cervival spinal cord. Expressed in Purkinje cells, oligodendrocytes and Schwann cells (at protein level). Expressed in the central nervous system (CNS). 2 s

Induction:

Developmental stage:In oligodendrocytes during differentiation of CG-4 cells. 1

Protein families:


   💬 WhatsApp