SR5A3_RAT   Q5RJM1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5RJM1

Recommended name:Polyprenal reductase Curated

EC number:EC:1.3.1.94

Alternative names:3-oxo-5-alpha-steroid 4-dehydrogenase 3 (EC:1.3.1.22 By Similarity) . EC:1.3.1.22 (UniProtKB | ENZYME | Rhea) By Similarity Steroid 5-alpha-reductase 3 (S5AR 3; SR type 3)

Cleaved into:

GeneID:

Gene names  (primary ):Srd5a3

Gene names  (synonym ):

Gene names  (ORF ):

Length:330

Mass:38,092

Sequence:MAGWAGAELSVLNPLRALWLLLAAAFLLALLLQLAPARLLPSCALFQDLIRYGKTKQSGSRRPAVCRAFDVPKRYFSHFYVVSVLWNGSLLWFLSQSLFLGAPFPSWLWALLRTLGVTQFQALGMESKASRIQGKKLALSTFLVLVFLWVHSLRRLFECFYVSVFSNTAIHVVQYCFGLVYYVLVGLTVLSQVPMNDKNVYALGKNLLLQARWFHILGMMMFFWSSAHQYKCHVILSNLRRNKKGVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGLHNVTWWLVVTYVFFSQALSAFFNHRFYKSTFVSYPKHRKAFLPFLF

Tissue specificity:Expressed in the 2 tissues tested i.e. testis and liver. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp