DCR1B_RAT Q4KLY6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q4KLY6
Recommended name：5' exonuclease Apollo
EC number：
Alternative names：Beta-lactamase MBLAC2 (EC:3.5.2.6 By Similarity) . EC:3.5.2.6 (UniProtKB | ENZYME | Rhea) By Similarity DNA cross-link repair 1B protein SNM1 homolog B
Cleaved into：
GeneID：310745
Gene names (primary )：Dclre1b
Gene names (synonym )：Snm1b
Gene names (ORF )：
Length：541
Mass：60,924
Sequence：MNGVVIPQTPIAVDFWSLRRAGTARLFFLSHMHCDHTVGLSSTWARPLYCSPITAHLLHRRLQVSKQWIRALEIGESHVLLLDEIGQETMTVTLIDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEATQQIIQLIRQFPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPQRLELVQLLGLADVFTVEEEAGRIHAVDHMEICHSAMLQWNQTHPTIAIFPTSRKIRSPHPSIYSIPYSDHSSYSELRAFVAALRPCQVVPIVREQPCGEFFQDSLSPRLSMPLIPHSVQQYMSSSSRKTNVFWQLERRLKRPRTQGVVFESPEEKADQVKVDRDSKKHKKESLSPWAGCLSRLCPHPLQARKQLFPDFCRKEGDEPVLFCDSNKMATVLTAPLELSVQLQPVDEFPFPETREEIGLGSPLWSGGGSGSPTRGKQSNGMGCGSPPTHISRTTHLTPESGGLALKYLLTPVDFLQAGFSSRNFDQQVEKHQRVQCNNPAVMNTVDDV
Tissue specificity：
Induction：
Developmental stage：
Protein families：DNA repair metallo-beta-lactamase (DRMBL) family