SELT_RAT Q1H5H1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q1H5H1
Recommended name：Thioredoxin reductase-like selenoprotein T Curated
EC number：EC:1.8.1.9
Alternative names：SelT By Similarity
Cleaved into：
GeneID：365802
Gene names (primary )：Selenot
Gene names (synonym )：Selt Imported
Gene names (ORF )：
Length：195
Mass：22,292
Sequence：MRLLLLLLVAASAVVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS
Tissue specificity：Ubiquitous, detected in all tissues tested. 1
Induction：Ubiquitously expressed as early as 7 dpc. 1 Publication
Developmental stage：Rapidly induced by ADCYAP1/PACAP neuropeptide and cAMP. 1
Protein families：