CGT_RAT   Q09426


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q09426

Recommended name:2-hydroxyacylsphingosine 1-beta-galactosyltransferase Curated

EC number:EC:2.4.1.47

Alternative names:Ceramide UDP-galactosyltransferase (CGalT) Cerebroside synthase UDP-galactose-ceramide galactosyltransferase

Cleaved into:

GeneID:50555

Gene names  (primary ):Ugt8

Gene names  (synonym ):Cgt, Ugt4

Gene names  (ORF ):

Length:541

Mass:61,126

Sequence:MKSYTPYFMLLWSAVGIARAAKIIIVPPIMFESHLYIFKTLASALHERGHHTVFLLSEGRDIDPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAVELVDILDHYTKNCDMMVGNQALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNFLERMKNTGVYLISRMGVSFLVLPKYERIMQKYNLLPAKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVDGAQEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGTKPKNLGNNTKLIEWLPQNDLLGHSNIRAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWNTVTEGELYDALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTTYWIDYILRHDGAHHLRSAVHQISFCQYFLLDIAFVLLLGAVALYFIVSYVTKFIYRKVKSLCSRSTHSTVNGHYQNGILNGRYKGNGHIKHEKKVK

Tissue specificity:Brain, restricted to the oligodendrocyte-containing cell layers of cerebrum and cerebellum.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp