SIA8B_RAT Q07977
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q07977
Recommended name：Alpha-2,8-sialyltransferase 8B Curated
EC number：EC:2.4.3.-
Alternative names：Sialyltransferase 8B (SIAT8-B) Sialyltransferase St8Sia II (ST8SiaII) Sialyltransferase X By Similarity (STX By Similarity)
Cleaved into：
GeneID：117523
Gene names (primary )：St8sia2
Gene names (synonym )：Siat8b, Stx By Similarity
Gene names (ORF )：
Length：375
Mass：42,400
Sequence：MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSLPAVADRSNESLKHSIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT
Tissue specificity：Expressed only in newborn brain. 1
Induction：
Developmental stage：Newborn. 1
Protein families：