CDK5_RAT Q03114
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q03114
Recommended name：Cyclin-dependent kinase 5 Imported
EC number：EC:2.7.11.1
Alternative names：Cell division protein kinase 5 Curated Cyclin-dependent-like kinase 5 Serine/threonine-protein kinase PSSALRE 1 Publication Tau protein kinase II catalytic subunit By Similarity (TPKII catalytic subunit By Similarity)
Cleaved into：
GeneID：140908
Gene names (primary )：Cdk5
Gene names (synonym )：Cdkn5 Imported, PSSALRE By Similarity
Gene names (ORF )：
Length：292
Mass：33,254
Sequence：MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSLLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Tissue specificity：Expressed in hippocampal neuronal synaptic termini (at protein level) (PubMed:23699505). Expressed predominantly in post-mitotic neurons of the central and peripheral nervous system 1
Induction：
Developmental stage：
Protein families：