UT1_RAT P97689
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97689
Recommended name:Urea transporter 1
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):Slc14a1
Gene names (synonym ):UT11, UT3
Gene names (ORF ):
Length:384
Mass:42,034
Sequence:MEDIPTMVKVDRGESQILSCRGRRCGLKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNPISGILILAGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSDKGDYFWWLIFPVSAMSMTCPVFSSALSSLFSKWDLPVFTLPFNMALSLYLSATGHYNTFFPSKLFMPVSSVPNITWSELSALELLKSLPVGVGQIYGCDNPWTGAIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFKDIYSGLWGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMTHLMAAVHLPACTWSFCLATLLFLLLTTENPNIYRMPLSKVTYSEENRIFYLQNKKRVVDSPL
Tissue specificity:Expressed in brain, spleen, kidney, testis and lung, with highest levels in brain. 1
Induction:
Developmental stage:
Protein families: