SMAD1_RAT P97588
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97588
Recommended name：Mothers against decapentaplegic homolog 1
EC number：
Alternative names：SMAD family member 1 (SMAD 1; Smad1)
Cleaved into：
GeneID：25671
Gene names (primary )：Smad1
Gene names (synonym )：Mad1, Madh1
Gene names (ORF )：
Length：468
Mass：52,713
Sequence：MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPHSHPFAQYPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMAQDGSQPMDTNMTNMTAPTLPAEINRGDVQAVAYEEPKHWCSIVYYELNNRVGERFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETEYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
Tissue specificity：Ubiquitous; present in liver, lung, stomach and spleen with lower level in heart, testes and skeletal muscle.
Induction：
Developmental stage：
Protein families：dwarfin/SMAD family