THTM_RAT P97532
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97532
Recommended name：3-mercaptopyruvate sulfurtransferase
EC number：EC:2.8.1.2
Alternative names：MST
Cleaved into：
GeneID：192172
Gene names (primary )：Mpst
Gene names (synonym )：
Gene names (ORF )：
Length：297
Mass：32,940
Sequence：MAAPQLFRALVSAQWVAEALKSPRASQPLKLLDASWYLPKLGRDARREFEERHIPGAAFFDIDRCSDHTSPYDHMLPSATHFADYAGSLGVSAATHVVIYDGSDQGLYSAPRVWWMFRAFGHHSVSLLDGGFRYWLSQNLPISSGKSPSEPAEFCAQLDPSFIKTHEDILENLDARRFQVVDARAAGRFQGTQPEPRDGIEPGHIPGSVNIPFTEFLTSEGLEKSPEEIQRLFQEKKVDLSKPLVATCGSGVTACHVVLGAFLCGKPDVPVYDGSWVEWYMRAQPEHVISQGRGKTL
Tissue specificity：Expressed in liver, heart, kidney and brain. Localizes to tubular epithelium in the kidney, pericentral hepatocytes in the liver, cardiac cells in the heart and neuroglial cells in the brain. Also expressed in vascular endothelium of the thoracic aorta. Weak expression in lung and thymus. 2 s
Induction：
Developmental stage：
Protein families：