GFRP_RAT   P70552


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70552

Recommended name:GTP cyclohydrolase 1 feedback regulatory protein

EC number:

Alternative names:GTP cyclohydrolase I feedback regulatory protein p35

Cleaved into:

GeneID:171128

Gene names  (primary ):Gchfr

Gene names  (synonym ):Gfrp

Gene names  (ORF ):

Length:84

Mass:9,672

Sequence:MPYLLISTQIRMEVGPTMVGDEHSDPELMQQLGASKRRVLGNNFYEYYVNDPPRIVLDKLECRGFRVLSMTGVGQTLVWCLHKE

Tissue specificity:Liver and kidney. Somewhat lower level in testis, heart, brain and lung.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp