UB2D2_RAT P62839
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62839
Recommended name：Ubiquitin-conjugating enzyme E2 D2
EC number：EC:2.3.2.23
Alternative names：(E3-independent) E2 ubiquitin-conjugating enzyme D2 (EC:2.3.2.24) . EC:2.3.2.24 (UniProtKB | ENZYME | Rhea) E2 ubiquitin-conjugating enzyme D2 Ubiquitin carrier protein D2 Ubiquitin-conjugating enzyme E2(17)KB 2 Ubiquitin-conjugating enzyme E2-17 kDa 2 Ubiquitin-protein ligase D2
Cleaved into：
GeneID：641452
Gene names (primary )：Ube2d2
Gene names (synonym )：Ubc4, Ubch4, Ubch5b
Gene names (ORF )：
Length：147
Mass：16,735
Sequence：MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
Tissue specificity：Highly expressed in testis. 1
Induction：
Developmental stage：
Protein families：