ADM2_RAT P61312
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61312
Recommended name：Protein ADM2
EC number：
Alternative names：Adrenomedullin-2 By similarity (AM2) Alternative names: Intermedin-long (IMDL) Intermedin-short (IMDS)
Cleaved into：
GeneID：399475
Gene names (primary )：Adm2
Gene names (synonym )：Am2
Gene names (ORF )：
Length：146
Mass：15,572
Sequence：MAQLLMVTVTFGCISLLYLLPGTLSGSLGKGLRPREPPAKIPSSGPQPGHPSLRPVVWKPPHALQPQGRGNPALATVHLPQGGGSRHPGPQRHVGSRRPHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSYG
Tissue specificity：Expression was restricted to the intermediate and anterior lobes of the pituitary. 1
Induction：
Developmental stage：
Protein families：