UB2D3_RAT P61078
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61078
Recommended name：Ubiquitin-conjugating enzyme E2 D3
EC number：EC:2.3.2.23
Alternative names：(E3-independent) E2 ubiquitin-conjugating enzyme D3 (EC:2.3.2.24) . EC:2.3.2.24 (UniProtKB | ENZYME | Rhea) E2 ubiquitin-conjugating enzyme D3 Phosphoarginine phosphatase (PAPase) Ubiquitin carrier protein D3 Ubiquitin-conjugating enzyme E2(17)KB 3 More alternative names
Cleaved into：
GeneID：81920
Gene names (primary )：Ube2d3
Gene names (synonym )：
Gene names (ORF )：
Length：147
Mass：16,687
Sequence：MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Tissue specificity：
Induction：
Developmental stage：
Protein families：