AQP8_RAT P56405
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56405
Recommended name：Aquaporin-8 1 Publication
EC number：
Alternative names：
Cleaved into：
GeneID：29172
Gene names (primary )：Aqp8 1 Publication
Gene names (synonym )：
Gene names (ORF )：
Length：263
Mass：28,055
Sequence：MSGEQTPMCSMDLREIKGKETNMADSYHGMSWYEQYIQPCVVELLGSALFIFIGCLSVIENSPNTGLLQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTLVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGVEIVMTMLLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDILAGGGISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLLIRLFIGDEKTRLILKSR
Tissue specificity：Highly expressed in sperm, pancreas and liver (PubMed:9299432, PubMed:9374520). Expressed in hepatocytes, acinal cells of pancreas and salivary gland, and absorptive colonic epithelial cells (PubMed:9374520). Expressed in the myoepithelium of submandibular and parotid glands (PubMed:16311720). Expressed in pancreatic beta-cells (PubMed:33892285). Expressed in testis but not in epididymis (PubMed:11369592). Expressed in small intestine (PubMed:18059526). 6 s
Induction：
Developmental stage：Up-regulated by glucagon. 1
Protein families：MIP/aquaporin (TC 1.A.8) family