AK1A1_RAT P51635
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51635
Recommended name:Aldo-keto reductase family 1 member A1
EC number:EC:1.1.1.2
Alternative names:3-DG-reducing enzyme 1 Publication Alcohol dehydrogenase [NADP(+)] Aldehyde reductase 1 Publication Glucuronate reductase 1 Publication (EC:1.1.1.19 1 Publication) . EC:1.1.1.19 (UniProtKB | ENZYME | Rhea) 1 Publication Glucuronolactone reductase 1 Publication (EC:1.1.1.20 1 Publication) . EC:1.1.1.20 (UniProtKB | ENZYME | Rhea) 1 Publication S-nitroso-CoA reductase Curated (ScorR Curated) (EC:1.6.-.- By Similarity) . EC:1.6.-.- (UniProtKB | ENZYME | Rhea) By Similarity
Cleaved into:
GeneID:78959
Gene names (primary ):Akr1a1
Gene names (synonym ):Alr
Gene names (ORF ):
Length:325
Mass:36,506
Sequence:MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY
Tissue specificity:Widely expressed. 1
Induction:
Developmental stage:
Protein families: