S1PR1_RAT P48303
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P48303
Recommended name：Sphingosine 1-phosphate receptor 1
EC number：
Alternative names：Endothelial differentiation G-protein coupled receptor 1 Sphingosine 1-phosphate receptor Edg-1 (S1P receptor Edg-1)
Cleaved into：
GeneID：29733
Gene names (primary )：S1pr1
Gene names (synonym )：Edg1
Gene names (ORF )：
Length：383
Mass：42,746
Sequence：MVSSTSIPVVKALRSQVSDYGNYDIIVRHYNYTGKLNIGVEKDHGIKLTSVVFILICCLIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPIMGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIISCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSSHPQKDDGDNPETIMSSGNVNSSS
Tissue specificity：First detected at embryonic day 15. At postnatal day 14 detected in skin, spleen, liver, kidney, heart, testicle, lung and brain. At adulthood is most abundant in brain. 1
Induction：
Developmental stage：
Protein families：