GPX4_RAT P36970
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P36970
Recommended name:Phospholipid hydroperoxide glutathione peroxidase 1 Publication
EC number:EC:1.11.1.12
Alternative names:PHGPx 1 Publication
Cleaved into:
GeneID:
Gene names (primary ):Gpx4 By Similarity
Gene names (synonym ):
Gene names (ORF ):
Length:197
Mass:22,225
Sequence:MSWGRLSRLLKPALLCGALAVPGLAGTMCASRDDWRCARSMHEFAAKDIDGHMVCLDKYRGCVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFAAGYNVRFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPQVIEKDLPCYL
Tissue specificity:Present primarily in testis (PubMed:1556123). Expressed in flagella of epididymal sperm (PubMed:19423663). Isoform Cytoplasmic: Highly expressed in testis (PubMed:14575705). Present in spermatogonia, spermatocyte and spermatid (at protein level) (PubMed:14575705). 3 s
Induction:
Developmental stage:
Protein families: