RAB12_RAT   P35284


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P35284

Recommended name:Ras-related protein Rab-12

EC number:EC:3.6.5.2

Alternative names:

Cleaved into:

GeneID:25530

Gene names  (primary ):Rab12

Gene names  (synonym ):

Gene names  (ORF ):

Length:243

Mass:27,271

Sequence:MDPSAALHRRPAGGGLGAVSPALSGGQARRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREISRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDVLRSELSNSILSLQPEPEIPPELPPPRPHVRCC

Tissue specificity:Highest levels in skeletal and cardiac muscle. Also found in comparable amounts in brain, spinal cord and lung. Also detected in testis where it is expressed by Sertoli cells of the seminiferous tubules (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp