NGAL_RAT   P30152


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P30152

Recommended name:Neutrophil gelatinase-associated lipocalin

EC number:

Alternative names:Alpha-2-microglobulin-related protein 1 Publication Alpha-2U globulin-related protein Lipocalin 24p3 1 Publication Lipocalin-2 Siderocalin LCN2 p25

Cleaved into:

GeneID:170496

Gene names  (primary ):Lcn2

Gene names  (synonym ):

Gene names  (ORF ):

Length:198

Mass:22,476

Sequence:MGLGVLCLALVLLGVLQSQAQDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAGNAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN

Tissue specificity:Detected in the ureteric bud in embryonic kidney (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp